Schlafen-Like 1 Antikörper (Middle Region)

Produktnummer ABIN632057

Der Kaninchen-Polyklonal Anti-Schlafen-Like 1-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von Schlafen-Like 1 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für Schlafen-Like 1 Antikörper (Middle Region) (ABIN632057)

Target: Schlafen-Like 1 (SLFNL1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Schlafen-Like 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Schlafen-Like 1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLFNL1 antibody was raised against the middle region of SLFNL1

Aufreinigung: Affinity purified

Immunogen: SLFNL1 antibody was raised using the middle region of SLFNL1 corresponding to a region with amino acids TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLFNL1 Blocking Peptide, (ABIN5616288), is also available for use as a blocking control in assays to test for specificity of this SLFNL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFNL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Schlafen-Like 1

Target: Schlafen-Like 1 (SLFNL1)

Andere Bezeichnung: SLFNL1

Hintergrund: SLFNL1 belongs to the Schlafen family. The function of the SLFNL1 protein remains unknown.

Molekulargewicht: 45 kDa (MW of target protein)