VPS53 Antikörper

Produktnummer ABIN632054

Der Kaninchen Polyklonal Anti-VPS53-Antikörper wurde für WB validiert. Er ist geeignet, VPS53 in Proben von Human zu detektieren.

Kurzübersicht für VPS53 Antikörper (ABIN632054)

Target: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS53 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VPS53 Antikörper

Aufreinigung: Affinity purified

Immunogen: VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS53 Blocking Peptide, (ABIN5616982), is also available for use as a blocking control in assays to test for specificity of this VPS53 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS53 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS53

Target: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Andere Bezeichnung: VPS53

Hintergrund: This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

Molekulargewicht: 92 kDa (MW of target protein)