UEVLD Antikörper (N-Term)

Produktnummer ABIN632053

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch UEVLD in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für UEVLD Antikörper (N-Term) (ABIN632053)

Target: UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UEVLD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UEVLD Antikörper

Bindungsspezifität: N-Term

Spezifität: UEVLD antibody was raised against the N terminal of UEVLD

Aufreinigung: Affinity purified

Immunogen: UEVLD antibody was raised using the N terminal of UEVLD corresponding to a region with amino acids FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UEVLD Blocking Peptide, (ABIN938339), is also available for use as a blocking control in assays to test for specificity of this UEVLD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UEVLD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UEVLD

Target: UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))

Andere Bezeichnung: UEVLD

Hintergrund: UEVLD is a possible negative regulator of polyubiquitination.

Molekulargewicht: 42 kDa (MW of target protein)