DCUN1D1 Antikörper

Produktnummer ABIN632052

Dieses Anti-DCUN1D1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DCUN1D1 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für DCUN1D1 Antikörper (ABIN632052)

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCUN1D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-DCUN1D1 Antikörper

Aufreinigung: Affinity purified

Immunogen: DCUN1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCUN1D1 Blocking Peptide, (ABIN5613143), is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCUN1D1

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Andere Bezeichnung: DCUN1D1

Hintergrund: DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.

Molekulargewicht: 28 kDa (MW of target protein)