Ubiquilin 1 Antikörper (Middle Region)

Produktnummer ABIN632051

Der Kaninchen Polyklonal anti-Ubiquilin 1 Antikörper wird verwendet zum Nachweis von Ubiquilin 1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Ubiquilin 1 Antikörper (Middle Region) (ABIN632051)

Target: Ubiquilin 1 (UBQLN1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ubiquilin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Ubiquilin 1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Ubiquilin 1 antibody was raised against the middle region of UBQLN1

Aufreinigung: Affinity purified

Immunogen: Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ubiquilin 1 Blocking Peptide, (ABIN5616882), is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ubiquilin 1

Target: Ubiquilin 1 (UBQLN1)

Andere Bezeichnung: Ubiquilin 1

Hintergrund: UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.

Molekulargewicht: 62 kDa (MW of target protein)