EFHA2 Antikörper (N-Term)

Produktnummer ABIN632049

Der Kaninchen Polyklonal anti-EFHA2 Antikörper (ABIN632049) detektiert spezifisch EFHA2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für EFHA2 Antikörper (N-Term) (ABIN632049)

Target: EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EFHA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EFHA2 Antikörper

Bindungsspezifität: N-Term

Spezifität: EFHA2 antibody was raised against the N terminal of EFHA2

Aufreinigung: Affinity purified

Immunogen: EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EFHA2 Blocking Peptide, (ABIN5613313), is also available for use as a blocking control in assays to test for specificity of this EFHA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFHA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EFHA2

Target: EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))

Andere Bezeichnung: EFHA2

Hintergrund: The function of EFHA protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 61 kDa (MW of target protein)