EN1 Antikörper (C-Term)

Produktnummer ABIN632046

Produktdetails anti-EN1 Antikörper

Target: EN1 (Engrailed Homeobox 1 (EN1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EN1 antibody was raised against the C terminal of EN1

Aufreinigung: Affinity purified

Immunogen: EN1 antibody was raised using the C terminal of EN1 corresponding to a region with amino acids LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EN1 Blocking Peptide, catalog no. 33R-5203, is also available for use as a blocking control in assays to test for specificity of this EN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EN1

Target: EN1 (Engrailed Homeobox 1 (EN1))

Andere Bezeichnung: EN1 (EN1 Produkte)

Synonyme: EN1 antikoerper, En-1 antikoerper, Mo-en.1 antikoerper, ENG-1 antikoerper, en-1 antikoerper, en1 antikoerper, eng1 antikoerper, zgc:100771 antikoerper, en1-A antikoerper, engrailed-1 antikoerper, xen1 antikoerper, Gg-En-1 antikoerper, en-3 antikoerper, engrailed antikoerper, engrailed homeobox 1 antikoerper, engrailed 1 antikoerper, engrailed homeobox 1a antikoerper, engrailed homeobox 1 S homeolog antikoerper, EN1 antikoerper, En1 antikoerper, en1a antikoerper, en1.S antikoerper

Hintergrund: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis