AGO1 Antikörper (N-Term)

Produktnummer ABIN632044

Produktdetails anti-AGO1 Antikörper

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF2 C1 antibody was raised against the N terminal of EIF2 1

Aufreinigung: Affinity purified

Immunogen: EIF2 C1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF2C1 Blocking Peptide, catalog no. 33R-5890, is also available for use as a blocking control in assays to test for specificity of this EIF2C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGO1

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Andere Bezeichnung: EIF2C1 (EIF2C1 Produkte)

Synonyme: Ago antikoerper, Ago-1 antikoerper, Ago1 antikoerper, CG6671 antikoerper, Dm Ago1 antikoerper, Dmel\\CG6671 antikoerper, MRE20 antikoerper, ago1 antikoerper, ago1-1 antikoerper, anon-WO0257455.29 antikoerper, dAGO1 antikoerper, dAgo1 antikoerper, l(2)04845 antikoerper, l(2)4845 antikoerper, l(2)k00208 antikoerper, l(2)k08121 antikoerper, GB12654 antikoerper, dsim_GLEANR_9718 antikoerper, DsimGD25729 antikoerper, GD25729 antikoerper, EIF2C1 antikoerper, EIF2C antikoerper, GERP95 antikoerper, Q99 antikoerper, Eif2c1 antikoerper, ARGONAUTE 1 antikoerper, T1N15.2 antikoerper, T1N15_2 antikoerper, Argonaute-1 antikoerper, protein argonaute-2 antikoerper, argonaute 1 antikoerper, Argonaute 1 antikoerper, protein argonaute-1 antikoerper, argonaute 1, RISC catalytic component antikoerper, argonaute RISC catalytic subunit 1 antikoerper, Stabilizer of iron transporter SufD / Polynucleotidyl transferase antikoerper, AGO1 antikoerper, LOC552062 antikoerper, ago1 antikoerper, LOC659936 antikoerper, Dsim\AGO1 antikoerper, Ago1 antikoerper, LOC100386910 antikoerper, LOC100482671 antikoerper, LOC475337 antikoerper

Hintergrund: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization