Phosphoglucomutase 1 Antikörper (Middle Region)

Produktnummer ABIN632042

Produktdetails anti-Phosphoglucomutase 1 Antikörper

Target: Phosphoglucomutase 1 (PGM1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Phosphoglucomutase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PGM1 antibody was raised against the middle region of PGM1

Aufreinigung: Affinity purified

Immunogen: PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGM1 Blocking Peptide, catalog no. 33R-1559, is also available for use as a blocking control in assays to test for specificity of this PGM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Phosphoglucomutase 1

Target: Phosphoglucomutase 1 (PGM1)

Andere Bezeichnung: PGM1 (PGM1 Produkte)

Hintergrund: PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process