TCP11L2 Antikörper

Produktnummer ABIN632040

Der Kaninchen Polyklonal anti-TCP11L2 Antikörper (ABIN632040) detektiert spezifisch TCP11L2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TCP11L2 Antikörper (ABIN632040)

Target: TCP11L2 (T-Complex 11, Testis-Specific-Like 2 (TCP11L2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCP11L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TCP11L2 Antikörper

Aufreinigung: Affinity purified

Immunogen: TCP11 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCP11L2 Blocking Peptide, (ABIN5616536), is also available for use as a blocking control in assays to test for specificity of this TCP11L2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCP11L2

Target: TCP11L2 (T-Complex 11, Testis-Specific-Like 2 (TCP11L2))

Andere Bezeichnung: TCP11L2

Hintergrund: The specific function of TCP11L2 is not yet known.

Molekulargewicht: 58 kDa (MW of target protein)