DCAF4 Antikörper (Middle Region)

Produktnummer ABIN632039

Produktdetails anti-DCAF4 Antikörper

Target: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCAF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR21 A antibody was raised against the middle region of WDR21

Aufreinigung: Affinity purified

Immunogen: WDR21 A antibody was raised using the middle region of WDR21 corresponding to a region with amino acids ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR21A Blocking Peptide, catalog no. 33R-1483, is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCAF4

Target: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Andere Bezeichnung: WDR21A (DCAF4 Produkte)

Synonyme: Wdr21 antikoerper, 1110018E21Rik antikoerper, WDR21 antikoerper, WDR21A antikoerper, DDB1 and CUL4 associated factor 4 antikoerper, Dcaf4 antikoerper, DCAF4 antikoerper

Hintergrund: This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Molekulargewicht: 56 kDa (MW of target protein)