FAM13C Antikörper (N-Term)

Produktnummer ABIN632036

Der Kaninchen Polyklonal anti-FAM13C Antikörper wird verwendet zum Nachweis von FAM13C in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für FAM13C Antikörper (N-Term) (ABIN632036)

Target: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM13C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM13C Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM13 C1 antibody was raised against the N terminal of FAM13 1

Aufreinigung: Affinity purified

Immunogen: FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM13C1 Blocking Peptide, (ABIN5613472), is also available for use as a blocking control in assays to test for specificity of this FAM13C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM13C

Target: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Andere Bezeichnung: FAM13C1

Hintergrund: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Molekulargewicht: 55 kDa (MW of target protein)