ALDH1L1 Antikörper (Middle Region)

Produktnummer ABIN632033

Produktdetails anti-ALDH1L1 Antikörper

Target: ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH1L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALDH1 L1 antibody was raised against the middle region of ALDH1 1

Aufreinigung: Affinity purified

Immunogen: ALDH1 L1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH1L1 Blocking Peptide, catalog no. 33R-5480, is also available for use as a blocking control in assays to test for specificity of this ALDH1L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH1L1

Target: ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))

Andere Bezeichnung: ALDH1L1 (ALDH1L1 Produkte)

Synonyme: 10-FTHFDH antikoerper, 10-fTHF antikoerper, FDH antikoerper, FTHFD antikoerper, Fthfd antikoerper, 1810048F20Rik antikoerper, Neut2 antikoerper, fthfd antikoerper, ALDH1L1 antikoerper, DKFZp469C068 antikoerper, aldehyde dehydrogenase 1 family member L1 antikoerper, aldehyde dehydrogenase 1 family, member L1 antikoerper, cytosolic 10-formyltetrahydrofolate dehydrogenase antikoerper, aldehyde dehydrogenase 1 family member L1 L homeolog antikoerper, ALDH1L1 antikoerper, Aldh1l1 antikoerper, aldh1l1 antikoerper, LOC476506 antikoerper, LOC100465263 antikoerper, aldh1l1.L antikoerper

Hintergrund: ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.

Molekulargewicht: 99 kDa (MW of target protein)