TCP11 Antikörper

Produktnummer ABIN632031

Der Kaninchen Polyklonal anti-TCP11 Antikörper (ABIN632031) detektiert spezifisch TCP11 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TCP11 Antikörper (ABIN632031)

Target: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCP11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TCP11 Antikörper

Aufreinigung: Affinity purified

Immunogen: TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCP11 Blocking Peptide, (ABIN937464), is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCP11

Target: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Andere Bezeichnung: TCP11

Hintergrund: TCP11 may play an important role in sperm function and fertility.

Molekulargewicht: 49 kDa (MW of target protein)