NOXRED1 Antikörper (Middle Region)

Produktnummer ABIN632026

Produktdetails anti-NOXRED1 Antikörper

Target: NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOXRED1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF148 antibody was raised against the middle region of C14 rf148

Aufreinigung: Affinity purified

Immunogen: C14 ORF148 antibody was raised using the middle region of C14 rf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF148 Blocking Peptide, catalog no. 33R-4517, is also available for use as a blocking control in assays to test for specificity of this C14ORF148 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF148 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOXRED1

Target: NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

Andere Bezeichnung: C14ORF148 (C14orf148 Produkte)

Synonyme: C14orf148 antikoerper, 4933437F05Rik antikoerper, NADP dependent oxidoreductase domain containing 1 antikoerper, NADP+ dependent oxidoreductase domain containing 1 antikoerper, NOXRED1 antikoerper, Noxred1 antikoerper

Hintergrund: C14Orf148 probably functions an an oxidoreductase.

Molekulargewicht: 39 kDa (MW of target protein)