Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

NOXRED1 Antikörper (Middle Region)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NOXRED1 in WB. Er zeigt eine Reaktivität gegenüber Human.
Produktnummer ABIN632026

Kurzübersicht für NOXRED1 Antikörper (Middle Region) (ABIN632026)

Target

Alle NOXRED1 (C14orf148) Antikörper anzeigen
NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

Reaktivität

  • 2
  • 2
  • 1
  • 1
  • 1
Human

Wirt

  • 2
Kaninchen

Klonalität

  • 2
Polyklonal

Konjugat

  • 2
Dieser NOXRED1 Antikörper ist unkonjugiert

Applikation

Western Blotting (WB)
  • Bindungsspezifität

    • 1
    • 1
    Middle Region

    Spezifität

    C14 ORF148 antibody was raised against the middle region of C14 rf148

    Aufreinigung

    Affinity purified

    Immunogen

    C14 ORF148 antibody was raised using the middle region of C14 rf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    C14ORF148 Blocking Peptide, (ABIN939903), is also available for use as a blocking control in assays to test for specificity of this C14ORF148 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF148 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    NOXRED1 (C14orf148) (Chromosome 14 Open Reading Frame 148 (C14orf148))

    Andere Bezeichnung

    C14ORF148

    Hintergrund

    C14Orf148 probably functions an an oxidoreductase.

    Molekulargewicht

    39 kDa (MW of target protein)
Sie sind hier:
Chat with us!