RAB40C Antikörper (N-Term)

Produktnummer ABIN632024

Der Kaninchen Polyklonal Anti-RAB40C-Antikörper wurde für WB validiert. Er ist geeignet, RAB40C in Proben von Human zu detektieren.

Kurzübersicht für RAB40C Antikörper (N-Term) (ABIN632024)

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB40C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB40C Antikörper

Bindungsspezifität: N-Term

Spezifität: RAB40 C antibody was raised against the N terminal of RAB40

Aufreinigung: Affinity purified

Immunogen: RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB40C Blocking Peptide, (ABIN5615714), is also available for use as a blocking control in assays to test for specificity of this RAB40C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB40C

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Andere Bezeichnung: RAB40C

Hintergrund: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molekulargewicht: 31 kDa (MW of target protein)