ALAD Antikörper (N-Term)

Produktnummer ABIN632017

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ALAD in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ALAD Antikörper (N-Term) (ABIN632017)

Target: ALAD (Aminolevulinate Dehydratase (ALAD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALAD Antikörper

Bindungsspezifität: N-Term

Spezifität: ALAD antibody was raised against the N terminal of ALAD

Aufreinigung: Affinity purified

Immunogen: ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALAD Blocking Peptide, (ABIN5612001), is also available for use as a blocking control in assays to test for specificity of this ALAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALAD

Target: ALAD (Aminolevulinate Dehydratase (ALAD))

Andere Bezeichnung: ALAD

Hintergrund: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.

Molekulargewicht: 37 kDa (MW of target protein)