FAM29A Antikörper (Middle Region)
-
- Target Alle FAM29A (HAUS6) Antikörper anzeigen
- FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM29A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM29 A antibody was raised against the middle region of Fam29
- Aufreinigung
- Affinity purified
- Immunogen
- FAM29 A antibody was raised using the middle region of Fam29 corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT
- Top Product
- Discover our top product HAUS6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM29A Blocking Peptide, catalog no. 33R-8198, is also available for use as a blocking control in assays to test for specificity of this FAM29A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))
- Andere Bezeichnung
- FAM29A (HAUS6 Produkte)
- Hintergrund
- FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.
- Molekulargewicht
- 108 kDa (MW of target protein)
-