DESI1 Antikörper (Middle Region)

Produktnummer ABIN632008

Produktdetails anti-DESI1 Antikörper

Target: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DESI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: D15 WSU75 antibody was raised against the middle region of D15 su75

Aufreinigung: Affinity purified

Immunogen: D15 WSU75 antibody was raised using the middle region of D15 su75 corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

D15WSU75E Blocking Peptide, catalog no. 33R-2991, is also available for use as a blocking control in assays to test for specificity of this D15WSU75E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of D10 SU70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DESI1

Target: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Andere Bezeichnung: D15WSU75E (PPPDE2 Produkte)

Synonyme: D15Wsu75e antikoerper, DESI2 antikoerper, DJ347H13.4 antikoerper, DeSI-1 antikoerper, FAM152B antikoerper, PPPDE2 antikoerper, AI427858 antikoerper, AI850401 antikoerper, Fam152b antikoerper, Pppde2 antikoerper, RGD1305776 antikoerper, fam152b antikoerper, pppde2 antikoerper, desumoylating isopeptidase 1 antikoerper, desumoylating isopeptidase 1 L homeolog antikoerper, DESI1 antikoerper, Desi1 antikoerper, desi1.L antikoerper

Hintergrund: The function of D15WSU75E protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 18 kDa (MW of target protein)