DESI1 Antikörper (Middle Region)

Produktnummer ABIN632008

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DESI1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DESI1 Antikörper (Middle Region) (ABIN632008)

Target: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DESI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DESI1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: D15 WSU75 antibody was raised against the middle region of D15 su75

Aufreinigung: Affinity purified

Immunogen: D15 WSU75 antibody was raised using the middle region of D15 su75 corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

D15WSU75E Blocking Peptide, (ABIN938377), is also available for use as a blocking control in assays to test for specificity of this D15WSU75E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of D10 SU70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DESI1

Target: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Andere Bezeichnung: D15WSU75E

Hintergrund: The function of D15WSU75E protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 18 kDa (MW of target protein)