Dystrobrevin beta Antikörper (C-Term)

Produktnummer ABIN632005

Produktdetails anti-Dystrobrevin beta Antikörper

Target: Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Dystrobrevin beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DTNB antibody was raised against the C terminal of DTNB

Aufreinigung: Affinity purified

Immunogen: DTNB antibody was raised using the C terminal of DTNB corresponding to a region with amino acids ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DTNB Blocking Peptide, catalog no. 33R-1524, is also available for use as a blocking control in assays to test for specificity of this DTNB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTNB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Dystrobrevin beta

Target: Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))

Andere Bezeichnung: DTNB (DTNB Produkte)

Synonyme: DTNB antikoerper, bdtn antikoerper, btnb antikoerper, dtnb antikoerper, GDTN antikoerper, dtng antikoerper, gtnb antikoerper, wu:fc61h11 antikoerper, dystrobrevin beta antikoerper, dystrobrevin, beta b antikoerper, dystrobrevin, beta antikoerper, dystrobrevin, beta a antikoerper, DTNB antikoerper, dtnbb antikoerper, Dtnb antikoerper, dtnba antikoerper, dtnb antikoerper

Hintergrund: DTNB is dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin.

Molekulargewicht: 64 kDa (MW of target protein)