C21orf59 Antikörper (N-Term)

Produktnummer ABIN632002

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch C21orf59 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für C21orf59 Antikörper (N-Term) (ABIN632002)

Target: C21orf59 (Chromosome 21 Open Reading Frame 59 (C21orf59))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C21orf59 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C21orf59 Antikörper

Bindungsspezifität: N-Term

Spezifität: C21 ORF59 antibody was raised against the N terminal Of C21 rf59

Aufreinigung: Affinity purified

Immunogen: C21 ORF59 antibody was raised using the N terminal Of C21 rf59 corresponding to a region with amino acids VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C21ORF59 Blocking Peptide, (ABIN5612492), is also available for use as a blocking control in assays to test for specificity of this C21ORF59 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF59 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C21orf59

Target: C21orf59 (Chromosome 21 Open Reading Frame 59 (C21orf59))

Andere Bezeichnung: C21ORF59

Hintergrund: The function of the C21orf59 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 33 kDa (MW of target protein)