EIF2AK1 Antikörper (N-Term)

Produktnummer ABIN631998

Produktdetails anti-EIF2AK1 Antikörper

Target: EIF2AK1 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 1 (EIF2AK1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF2AK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF2 AK1 antibody was raised against the N terminal of EIF2 K1

Aufreinigung: Affinity purified

Immunogen: EIF2 AK1 antibody was raised using the N terminal of EIF2 K1 corresponding to a region with amino acids TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF2AK1 Blocking Peptide, catalog no. 33R-9000, is also available for use as a blocking control in assays to test for specificity of this EIF2AK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 K1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF2AK1

Target: EIF2AK1 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 1 (EIF2AK1))

Andere Bezeichnung: EIF2AK1 (EIF2AK1 Produkte)

Synonyme: HCR antikoerper, Hri antikoerper, HRI antikoerper, wu:fj97h09 antikoerper, zgc:153232 antikoerper, eukaryotic translation initiation factor 2 alpha kinase 1 antikoerper, eukaryotic translation initiation factor 2-alpha kinase 1 antikoerper, eukaryotic translation initiation factor 2 alpha kinase 1 L homeolog antikoerper, EIF2AK1 antikoerper, eif2ak1 antikoerper, Eif2ak1 antikoerper, eif2ak1.L antikoerper

Hintergrund: EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: Hepatitis C