C11orf46 Antikörper (N-Term)

Produktnummer ABIN631992

Dieses Anti-C11orf46-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von C11orf46 in WB. Geeignet für Human und Maus.

Kurzübersicht für C11orf46 Antikörper (N-Term) (ABIN631992)

Target: C11orf46 (Chromosome 11 Open Reading Frame 46 (C11orf46))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C11orf46 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C11orf46 Antikörper

Bindungsspezifität: N-Term

Spezifität: C11 ORF46 antibody was raised against the N terminal Of C11 rf46

Aufreinigung: Affinity purified

Immunogen: C11 ORF46 antibody was raised using the N terminal Of C11 rf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF46 Blocking Peptide, (ABIN5612389), is also available for use as a blocking control in assays to test for specificity of this C11ORF46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C11orf46

Target: C11orf46 (Chromosome 11 Open Reading Frame 46 (C11orf46))

Andere Bezeichnung: C11ORF46

Hintergrund: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 29 kDa (MW of target protein)