BRIX1 Antikörper (Middle Region)

Produktnummer ABIN631990

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch BRIX1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für BRIX1 Antikörper (Middle Region) (ABIN631990)

Target: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BRIX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BRIX1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: BXDC2 antibody was raised against the middle region of Bxdc2

Aufreinigung: Affinity purified

Immunogen: BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BXDC2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BRIX1

Target: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Andere Bezeichnung: BXDC2

Hintergrund: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Molekulargewicht: 41 kDa (MW of target protein)