PRR16 Antikörper (Middle Region)

Produktnummer ABIN631986

Dieses Anti-PRR16-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PRR16 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PRR16 Antikörper (Middle Region) (ABIN631986)

Target: PRR16 (Proline Rich 16 (PRR16))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRR16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRR16 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PRR16 antibody was raised against the middle region of PRR16

Aufreinigung: Affinity purified

Immunogen: PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRR16 Blocking Peptide, (ABIN5615592), is also available for use as a blocking control in assays to test for specificity of this PRR16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRR16

Target: PRR16 (Proline Rich 16 (PRR16))

Andere Bezeichnung: PRR16

Hintergrund: The function of PRR16 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)