Syntaxin 19 Antikörper (N-Term)

Produktnummer ABIN631981

Produktdetails anti-Syntaxin 19 Antikörper

Target: Syntaxin 19 (STX19)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Syntaxin 19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Syntaxin 19 antibody was raised against the N terminal of STX19

Aufreinigung: Affinity purified

Immunogen: Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Syntaxin 19 Blocking Peptide, catalog no. 33R-5327, is also available for use as a blocking control in assays to test for specificity of this Syntaxin 19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STX19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Syntaxin 19

Target: Syntaxin 19 (STX19)

Andere Bezeichnung: Syntaxin 19 (STX19 Produkte)

Synonyme: A030009B12Rik antikoerper, syntaxin 19 antikoerper, syntaxin 19 L homeolog antikoerper, STX19 antikoerper, stx19.L antikoerper, stx19 antikoerper, Stx19 antikoerper

Hintergrund: The function of Syntaxin 19 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 34 kDa (MW of target protein)