RSPH10B Antikörper
-
- Target Alle RSPH10B Produkte
- RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RSPH10B Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RSPH10 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RSPH10B Blocking Peptide, catalog no. 33R-2414, is also available for use as a blocking control in assays to test for specificity of this RSPH10B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPH10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))
- Andere Bezeichnung
- RSPH10B (RSPH10B Produkte)
- Hintergrund
- The function of RSPH10B protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 96 kDa (MW of target protein)
-