NHLRC2 Antikörper (N-Term)

Produktnummer ABIN631979

Der Kaninchen-Polyklonal Anti-NHLRC2-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von NHLRC2 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für NHLRC2 Antikörper (N-Term) (ABIN631979)

Target: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NHLRC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NHLRC2 Antikörper

Bindungsspezifität: N-Term

Spezifität: NHLRC2 antibody was raised against the N terminal of NHLRC2

Aufreinigung: Affinity purified

Immunogen: NHLRC2 antibody was raised using the N terminal of NHLRC2 corresponding to a region with amino acids YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NHLRC2 Blocking Peptide, (ABIN936212), is also available for use as a blocking control in assays to test for specificity of this NHLRC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHLRC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NHLRC2

Target: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Andere Bezeichnung: NHLRC2

Hintergrund: The function of NHLRC2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 79 kDa (MW of target protein)