ZADH2 Antikörper (N-Term)

Produktnummer ABIN631977

Produktdetails anti-ZADH2 Antikörper

Target: ZADH2 (Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZADH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZADH2 antibody was raised against the N terminal of ZADH2

Aufreinigung: Affinity purified

Immunogen: ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZADH2 Blocking Peptide, catalog no. 33R-3114, is also available for use as a blocking control in assays to test for specificity of this ZADH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZADH2

Target: ZADH2 (Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2))

Andere Bezeichnung: ZADH2 (ZADH2 Produkte)

Synonyme: ZADH2 antikoerper, C530046K17Rik antikoerper, zinc binding alcohol dehydrogenase domain containing 2 antikoerper, zinc binding alcohol dehydrogenase, domain containing 2 antikoerper, ZADH2 antikoerper, Zadh2 antikoerper

Hintergrund: The function of ZADH2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 43 kDa (MW of target protein)