NOB1 Antikörper

Produktnummer ABIN631975

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NOB1 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für NOB1 Antikörper (ABIN631975)

Target: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOB1 Antikörper

Aufreinigung: Affinity purified

Immunogen: NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOB1 Blocking Peptide, (ABIN5615016), is also available for use as a blocking control in assays to test for specificity of this NOB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOB1

Target: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Andere Bezeichnung: NOB1

Hintergrund: NOB1 may play a role in mRNA degradation.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus