FSIP1 Antikörper (Middle Region)

Produktnummer ABIN631970

Produktdetails anti-FSIP1 Antikörper

Target: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FSIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FSIP1 antibody was raised against the middle region of FSIP1

Aufreinigung: Affinity purified

Immunogen: FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FSIP1 Blocking Peptide, catalog no. 33R-1906, is also available for use as a blocking control in assays to test for specificity of this FSIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FSIP1

Target: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Andere Bezeichnung: FSIP1 (FSIP1 Produkte)

Synonyme: zgc:113106 antikoerper, 1700012M13Rik antikoerper, 4933432K11Rik antikoerper, fibrous sheath interacting protein 1 antikoerper, fibrous sheath-interacting protein 1 antikoerper, FSIP1 antikoerper, Fsip1 antikoerper, fsip1 antikoerper

Hintergrund: The function of FSIP1 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 66 kDa (MW of target protein)