FSIP1 Antikörper (Middle Region)

Produktnummer ABIN631970

Der Kaninchen Polyklonal anti-FSIP1 Antikörper wird verwendet zum Nachweis von FSIP1 in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für FSIP1 Antikörper (Middle Region) (ABIN631970)

Target: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FSIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FSIP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FSIP1 antibody was raised against the middle region of FSIP1

Aufreinigung: Affinity purified

Immunogen: FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FSIP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FSIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FSIP1

Target: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Andere Bezeichnung: FSIP1

Hintergrund: The function of FSIP1 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 66 kDa (MW of target protein)