SPICE1 Antikörper (N-Term)

Produktnummer ABIN631969

Produktdetails anti-SPICE1 Antikörper

Target: SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPICE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC52 antibody was raised against the N terminal of CCDC52

Aufreinigung: Affinity purified

Immunogen: CCDC52 antibody was raised using the N terminal of CCDC52 corresponding to a region with amino acids TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC52 Blocking Peptide, catalog no. 33R-9371, is also available for use as a blocking control in assays to test for specificity of this CCDC52 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC52 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPICE1

Target: SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))

Andere Bezeichnung: CCDC52 (SPICE1 Produkte)

Synonyme: CCDC52 antikoerper, ccdc52 antikoerper, zgc:101558 antikoerper, SPICE antikoerper, Ccdc52 antikoerper, D16Ertd480e antikoerper, RGD1310729 antikoerper, spindle and centriole associated protein 1 antikoerper, spindle and centriole associated protein 1 L homeolog antikoerper, SPICE1 antikoerper, spice1 antikoerper, Spice1 antikoerper, spice1.L antikoerper

Hintergrund: The specific function of CCDC52 is not yet known.

Molekulargewicht: 96 kDa (MW of target protein)