FAM76B Antikörper (Middle Region)

Produktnummer ABIN631968

Produktdetails anti-FAM76B Antikörper

Target: FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM76B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM76 B antibody was raised against the middle region of FAM76

Aufreinigung: Affinity purified

Immunogen: FAM76 B antibody was raised using the middle region of FAM76 corresponding to a region with amino acids QQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM76B Blocking Peptide, catalog no. 33R-7689, is also available for use as a blocking control in assays to test for specificity of this FAM76B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM76B

Target: FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))

Andere Bezeichnung: FAM76B (FAM76B Produkte)

Synonyme: fa11h02 antikoerper, wu:fa11h02 antikoerper, zgc:73333 antikoerper, 2810485I05Rik antikoerper, C78303 antikoerper, RGD1311077 antikoerper, family with sequence similarity 76 member B antikoerper, family with sequence similarity 76, member B antikoerper, family with sequence similarity 76 member B S homeolog antikoerper, FAM76B antikoerper, fam76b antikoerper, fam76b.S antikoerper, Fam76b antikoerper

Hintergrund: FAM76B belongs to the FAM76 family. The function of the FAM76B protein remains unknown.

Molekulargewicht: 39 kDa (MW of target protein)