DPH2 Antikörper

Produktnummer ABIN631965

Dieser Anti-DPH2 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von DPH2 in WB. Geeignet für Human.

Kurzübersicht für DPH2 Antikörper (ABIN631965)

Target: DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DPH2 Antikörper

Aufreinigung: Affinity purified

Immunogen: DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPH2 Blocking Peptide, (ABIN937132), is also available for use as a blocking control in assays to test for specificity of this DPH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPH2

Target: DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))

Andere Bezeichnung: DPH2

Hintergrund: This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2.

Molekulargewicht: 52 kDa (MW of target protein)