TPD52 Antikörper (Middle Region)

Produktnummer ABIN631964

Der Kaninchen Polyklonal Anti-TPD52-Antikörper wurde für WB validiert. Er ist geeignet, TPD52 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für TPD52 Antikörper (Middle Region) (ABIN631964)

Target: TPD52 (Tumor Protein D52 (TPD52))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPD52 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TPD52 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TPD52 antibody was raised against the middle region of TPD52

Aufreinigung: Affinity purified

Immunogen: TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPD52 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TPD52 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD52 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPD52

Target: TPD52 (Tumor Protein D52 (TPD52))

Andere Bezeichnung: TPD52

Hintergrund: TPD52 belongs to the TPD52 family. Its exact function remains unknown.

Molekulargewicht: 24 kDa (MW of target protein)