FBP2 Antikörper (Middle Region)

Produktnummer ABIN631962

Dieser Anti-FBP2 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von FBP2 in WB. Geeignet für Human und Ratte.

Kurzübersicht für FBP2 Antikörper (Middle Region) (ABIN631962)

Target: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FBP2 antibody was raised against the middle region of FBP2

Aufreinigung: Affinity purified

Immunogen: FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBP2 Blocking Peptide, (ABIN936008), is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBP2

Target: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Andere Bezeichnung: FBP2

Hintergrund: FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.

Molekulargewicht: 37 kDa (MW of target protein)