WDR1 Antikörper (N-Term)

Produktnummer ABIN631958

Der Kaninchen Polyklonal Anti-WDR1-Antikörper wurde für WB validiert. Er ist geeignet, WDR1 in Proben von Human zu detektieren.

Kurzübersicht für WDR1 Antikörper (N-Term) (ABIN631958)

Target: WDR1 (WD Repeat Domain 1 (WDR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WDR1 Antikörper

Bindungsspezifität: N-Term

Spezifität: WDR1 antibody was raised against the N terminal of WDR1

Aufreinigung: Affinity purified

Immunogen: WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR1 Blocking Peptide, (ABIN937374), is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR1

Target: WDR1 (WD Repeat Domain 1 (WDR1))

Andere Bezeichnung: WDR1

Hintergrund: WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: Sensory Perception of Sound