WDR1 Antikörper (N-Term)
Kurzübersicht für WDR1 Antikörper (N-Term) (ABIN631958)
Target
Alle WDR1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- WDR1 antibody was raised against the N terminal of WDR1
-
Aufreinigung
- Affinity purified
-
Immunogen
- WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
WDR1 Blocking Peptide, (ABIN937374), is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- WDR1 (WD Repeat Domain 1 (WDR1))
-
Andere Bezeichnung
- WDR1
-
Hintergrund
- WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.
-
Molekulargewicht
- 66 kDa (MW of target protein)
-
Pathways
- Sensory Perception of Sound
Target
-