MDH1B Antikörper
-
- Target Alle MDH1B Antikörper anzeigen
- MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MDH1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MDH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV
- Top Product
- Discover our top product MDH1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MDH1B Blocking Peptide, catalog no. 33R-10218, is also available for use as a blocking control in assays to test for specificity of this MDH1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))
- Andere Bezeichnung
- MDH1B (MDH1B Produkte)
- Hintergrund
- The function of MDH1B protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 59 kDa (MW of target protein)
-