MDH1B Antikörper

Produktnummer ABIN631954

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MDH1B in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für MDH1B Antikörper (ABIN631954)

Target: MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDH1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MDH1B Antikörper

Aufreinigung: Affinity purified

Immunogen: MDH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MDH1B Blocking Peptide, (ABIN936191), is also available for use as a blocking control in assays to test for specificity of this MDH1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MDH1B

Target: MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))

Andere Bezeichnung: MDH1B

Hintergrund: The function of MDH1B protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 59 kDa (MW of target protein)