ANKRD5 Antikörper (N-Term)

Produktnummer ABIN631952

Produktdetails anti-ANKRD5 Antikörper

Target: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKRD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANKRD5 antibody was raised against the N terminal of ANKRD5

Aufreinigung: Affinity purified

Immunogen: ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD5 Blocking Peptide, catalog no. 33R-6546, is also available for use as a blocking control in assays to test for specificity of this ANKRD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKRD5

Target: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Andere Bezeichnung: ANKRD5 (ANKRD5 Produkte)

Synonyme: anr5 antikoerper, MGC146428 antikoerper, DKFZp469P046 antikoerper, ANKRD5 antikoerper, dJ839B4.6 antikoerper, AV276460 antikoerper, Ankrd5 antikoerper, ankyrin repeat and EF-hand domain containing 1 L homeolog antikoerper, ankyrin repeat and EF-hand domain containing 1 antikoerper, ankef1.L antikoerper, ankef1 antikoerper, ANKEF1 antikoerper, Ankef1 antikoerper

Hintergrund: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 87 kDa (MW of target protein)