Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

ANKRD5 Antikörper (N-Term)

Der Kaninchen Polyklonal Anti-ANKRD5-Antikörper wurde für WB validiert. Er ist geeignet, ANKRD5 in Proben von Human zu detektieren.
Produktnummer ABIN631952

Kurzübersicht für ANKRD5 Antikörper (N-Term) (ABIN631952)

Target

ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Reaktivität

  • 18
  • 13
  • 12
  • 4
  • 4
  • 4
  • 3
  • 1
  • 1
  • 1
Human

Wirt

  • 34
  • 1
Kaninchen

Klonalität

  • 35
Polyklonal

Konjugat

  • 13
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser ANKRD5 Antikörper ist unkonjugiert

Applikation

  • 15
  • 14
  • 13
  • 13
  • 9
  • 6
  • 3
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 15
    • 8
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    ANKRD5 antibody was raised against the N terminal of ANKRD5

    Aufreinigung

    Affinity purified

    Immunogen

    ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    ANKRD5 Blocking Peptide, (ABIN5612069), is also available for use as a blocking control in assays to test for specificity of this ANKRD5 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD5 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

    Andere Bezeichnung

    ANKRD5

    Hintergrund

    The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

    Molekulargewicht

    87 kDa (MW of target protein)
Sie sind hier:
Chat with us!