ANKRD2 Antikörper

Produktnummer ABIN631951

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ANKRD2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für ANKRD2 Antikörper (ABIN631951)

Target: ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKRD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANKRD2 Antikörper

Aufreinigung: Affinity purified

Immunogen: ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD2 Blocking Peptide, catalog no. 33R-7516, is also available for use as a blocking control in assays to test for specificity of this ANKRD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKRD2

Target: ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))

Andere Bezeichnung: ANKRD2

Hintergrund: ANKRD2 may play an important role in skeletal muscle hypertrophy.

Molekulargewicht: 49 kDa (MW of target protein)