ASCC2 Antikörper (Middle Region)
-
- Target Alle ASCC2 Antikörper anzeigen
- ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASCC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ASCC2 antibody was raised against the middle region of ASCC2
- Aufreinigung
- Affinity purified
- Immunogen
- ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD
- Top Product
- Discover our top product ASCC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASCC2 Blocking Peptide, catalog no. 33R-10082, is also available for use as a blocking control in assays to test for specificity of this ASCC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASCC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))
- Andere Bezeichnung
- ASCC2 (ASCC2 Produkte)
- Synonyme
- MGC63666 antikoerper, zgc:63666 antikoerper, ASCC2 antikoerper, ascc2 antikoerper, asc1p100 antikoerper, ASC1p100 antikoerper, p100 antikoerper, 1700011I11Rik antikoerper, 2610034L15Rik antikoerper, AI482016 antikoerper, AW046480 antikoerper, RGD1561422 antikoerper, activating signal cointegrator 1 complex subunit 2 antikoerper, activating signal cointegrator 1 complex subunit 2 S homeolog antikoerper, ascc2 antikoerper, ASCC2 antikoerper, MCYG_08331 antikoerper, ascc2.S antikoerper, Ascc2 antikoerper
- Hintergrund
- ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.
- Molekulargewicht
- 86 kDa (MW of target protein)
-