ASCC2 Antikörper (Middle Region)

Produktnummer ABIN631946

Der Kaninchen Polyklonal anti-ASCC2 Antikörper wird verwendet zum Nachweis von ASCC2 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für ASCC2 Antikörper (Middle Region) (ABIN631946)

Target: ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASCC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASCC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ASCC2 antibody was raised against the middle region of ASCC2

Aufreinigung: Affinity purified

Immunogen: ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASCC2 Blocking Peptide, (ABIN936042), is also available for use as a blocking control in assays to test for specificity of this ASCC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASCC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASCC2

Target: ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))

Andere Bezeichnung: ASCC2

Hintergrund: ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.

Molekulargewicht: 86 kDa (MW of target protein)