ZCCHC24 Antikörper (Middle Region)

Produktnummer ABIN631945

Produktdetails anti-ZCCHC24 Antikörper

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZCCHC24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C10 ORF56 antibody was raised against the middle region of C10 rf56

Aufreinigung: Affinity purified

Immunogen: C10 ORF56 antibody was raised using the middle region of C10 rf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C10ORF56 Blocking Peptide, catalog no. 33R-5470, is also available for use as a blocking control in assays to test for specificity of this C10ORF56 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZCCHC24

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Andere Bezeichnung: C10ORF56 (ZCCHC24 Produkte)

Synonyme: RGD1306164 antikoerper, fc45d05 antikoerper, wu:fc45d05 antikoerper, zgc:158323 antikoerper, C10orf56 antikoerper, 2310047A01Rik antikoerper, zinc finger CCHC-type containing 24 antikoerper, zinc finger, CCHC domain containing 24 antikoerper, Zcchc24 antikoerper, ZCCHC24 antikoerper, zcchc24 antikoerper

Hintergrund: C10orf56 is probably involved in oxidoreductase activity.

Molekulargewicht: 27 kDa (MW of target protein)