ZCCHC24 Antikörper (Middle Region)

Produktnummer ABIN631945

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch ZCCHC24 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ZCCHC24 Antikörper (Middle Region) (ABIN631945)

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZCCHC24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZCCHC24 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C10 ORF56 antibody was raised against the middle region of C10 rf56

Aufreinigung: Affinity purified

Immunogen: C10 ORF56 antibody was raised using the middle region of C10 rf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C10ORF56 Blocking Peptide, (ABIN5612384), is also available for use as a blocking control in assays to test for specificity of this C10ORF56 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZCCHC24

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Andere Bezeichnung: C10ORF56

Hintergrund: C10orf56 is probably involved in oxidoreductase activity.

Molekulargewicht: 27 kDa (MW of target protein)