FAM82A1 Antikörper (Middle Region)

Produktnummer ABIN631940

Produktdetails anti-FAM82A1 Antikörper

Target: FAM82A1 (RMDN2) (Regulator of Microtubule Dynamics 2 (RMDN2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM82A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM82 A antibody was raised against the middle region of Fam82

Aufreinigung: Affinity purified

Immunogen: FAM82 A antibody was raised using the middle region of Fam82 corresponding to a region with amino acids WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM82A Blocking Peptide, catalog no. 33R-10000, is also available for use as a blocking control in assays to test for specificity of this FAM82A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM82A1

Target: FAM82A1 (RMDN2) (Regulator of Microtubule Dynamics 2 (RMDN2))

Andere Bezeichnung: FAM82A (RMDN2 Produkte)

Hintergrund: FAM82A belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the FAM82A protein remains unknown.

Molekulargewicht: 65 kDa (MW of target protein)