TMEM184A Antikörper (C-Term)

Produktnummer ABIN631931

Der Kaninchen Polyklonal anti-TMEM184A Antikörper wird verwendet zum Nachweis von TMEM184A in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TMEM184A Antikörper (C-Term) (ABIN631931)

Target: TMEM184A (Transmembrane Protein 184A (TMEM184A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM184A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM184A Antikörper

Bindungsspezifität: C-Term

Spezifität: TMEM184 A antibody was raised against the C terminal of TMEM184

Aufreinigung: Affinity purified

Immunogen: TMEM184 A antibody was raised using the C terminal of TMEM184 corresponding to a region with amino acids CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM184A Blocking Peptide, (ABIN937174), is also available for use as a blocking control in assays to test for specificity of this TMEM184A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM180 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM184A

Target: TMEM184A (Transmembrane Protein 184A (TMEM184A))

Andere Bezeichnung: TMEM184A

Hintergrund: TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Molekulargewicht: 46 kDa (MW of target protein)